PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009780151.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 202aa    MW: 22740.2 Da    PI: 10.3849
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009780151.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.71.3e-171562249
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    +i+n++n q +fs+R +g++KKA+EL++L +aeva++ fs  +k+y +
  XP_009780151.1 15 KIQNERNLQASFSRRHAGLFKKASELCTLSGAEVALVGFSLGNKVYSF 62
                    599*******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.0E-22665IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.806666IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-19774IPR002100Transcription factor, MADS-box
CDDcd001208.78E-24765No hitNo description
PRINTSPR004044.6E-13828IPR002100Transcription factor, MADS-box
PfamPF003195.2E-191562IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-132843IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-134364IPR002100Transcription factor, MADS-box
Gene3DG3DSA:3.40.1090.107.6E-8146202No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MGRKSNGRKK IDMVKIQNER NLQASFSRRH AGLFKKASEL CTLSGAEVAL VGFSLGNKVY  60
SFGHPYMDLV MVRCRTCDSG FAINCGLGLA FANPDSLIKP RICKKRLHKS KLGVWQMRIN  120
VRNSEPRQIW KTSQMRRDDT IAATEPHYHL LNFNENALTG TTTQMDNATE ANMNLLVQVG  180
ENLSKKPVSK ENPETNEEAL KK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1oxw_A4e-18151202304355Patatin
1oxw_B4e-18151202304355Patatin
1oxw_C4e-18151202304355Patatin
4pk9_A4e-18151202304355Patatin-17
4pka_X4e-18151202304355Patatin-17
4pkb_A4e-18151202304355Patatin-17
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankNTU684831e-108U68483.1 Nicotiana tabacum patatin homolog gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009780151.11e-152PREDICTED: MADS-box transcription factor 17-like
RefseqXP_016436586.11e-152PREDICTED: MADS-box transcription factor 17-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2355422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-27AGAMOUS-like 62